2. Search Result
Search Result
Results for "

TAT peptide

" in MedChemExpress (MCE) Product Catalog:

50

Inhibitors & Agonists

70

Peptides

1

Natural
Products

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P0282A
    TAT peptide TFA

    		HIV Infection
    TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
    <em>TAT</em> <em>peptide</em> TFA
  • HY-P4108
    TAT-HA2 Fusion Peptide

    		Influenza Virus Others
    TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety .
    <em>TAT</em>-HA2 Fusion <em>Peptide</em>
  • HY-P0282
    TAT peptide

    		HIV Infection
    TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
    <em>TAT</em> <em>peptide</em>
  • HY-P10106
    TAT-PAK18 inhibitory peptide

    		PAK Cancer
    TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
    <em>TAT</em>-PAK18 inhibitory <em>peptide</em>
  • HY-P5395
    TAT-GluR23A Fusion Peptide

    		HIV Others
    TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
    <em>TAT</em>-GluR23A Fusion <em>Peptide</em>
  • HY-P4101
    Cys(Npys)-TAT (47-57)

    		HIV Infection
    Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated cysteine residue C. TAT is a small nuclear transcriptional activator protein encoded by HIV-1 .
    Cys(Npys)-TAT (47-57)
  • HY-P5320
    TAT-BH4 (Bcl-xL)

    		Apoptosis Others
    TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
    TAT-BH4 (Bcl-xL)
  • HY-P5320A
    TAT-BH4 (Bcl-xL) (TFA)

    		Apoptosis Others
    TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
    TAT-BH4 (Bcl-xL) (TFA)
  • HY-P5307
    Peptide A5K

    INF7-A5K-TAT

    		 Biochemical Assay Reagents Others
    Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells. Peptide A5K effectively edits T cells without substantial impact on T cell viability .
    <em>Peptide</em> A5K
  • HY-P4125
    FITC-LC-TAT (47-57)

    		HIV Others
    FITC-LC-TAT (47-57) is a FITC labeled TAT peptide. TAT is a cell-penetrating peptide (CPP). TAT can increase the yields and the solubility of heterologous proteins .
    FITC-LC-TAT (47-57)
  • HY-P5891
    TAT-SAMβA

    		PKC Cardiovascular Disease
    TAT-SAMβA is the peptide consist of RNAENFDRF (SAMβA; HY-P3429) conjugated to the cell penetrating TAT protein-derived peptide TAT47–57. TAT-SAMβA is a selective antagonist of Mfn1-βIIPKC association. TAT-SAMβA protects mouse embryonic fibroblast cells (MEFs) against oxidative stress-induced cytotoxicity .
    TAT-SAMβA
  • HY-P0281A
    TAT TFA

    		HIV Infection
    TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
    TAT TFA
  • HY-P0281
    TAT

    		HIV Infection
    TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
    TAT
  • HY-P10074
    TAT-MEK1

    		ERK Inflammation/Immunology
    TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
    TAT-MEK1
  • HY-P5117
    TAT-CIRP

    		Toll-like Receptor (TLR) Neurological Disease
    TAT-CIRP is a a small peptide, refers to Trans-trans-activating (Tat)-cold-inducible RNA binding protein. TAT-CIRP is an inhibitor of myeloid differentiation protein 2 (MD2). TAT-CIRP exhibits robust neuroprotection against ischemic and hemorrhagic stroke in mice .
    TAT-CIRP
  • HY-P1575
    TAT (48-57)

    		HIV Infection
    TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
    TAT (48-57)
  • HY-P10076
    TAT-JBD20

    L-HIV-TAT(48–57)-PP-JBD20

    		 JNK Metabolic Disease
    TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
    TAT-JBD20
  • HY-P4106
    Tat-GluR23Y, scrambled

    		Amino Acid Derivatives Neurological Disease
    Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
    Tat-GluR23Y, scrambled
  • HY-P4106A
    Tat-GluR23Y, scrambled TFA

    		Amino Acid Derivatives Neurological Disease
    Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
    Tat-GluR23Y, scrambled TFA
  • HY-P5381
    gp91 ds-tat

    		NADPH Oxidase Others
    gp91 ds-tat is a biological active peptide. (NADPH oxidase assembly peptide inhibitor)
    gp91 ds-tat
  • HY-P1575A
    TAT (48-57) (TFA)

    		HIV Infection
    TAT (48-57) (TFA) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57 .
    TAT (48-57) (TFA)
  • HY-P4122
    TAT (47-57), FAM-labeled

    		HIV Others
    TAT (47-57), FAM-labeled is a cell-penetrating peptide (CPP). TAT (47-57), FAM-labeled has the potential for intracellular drug delivery research .
    TAT (47-57), FAM-labeled
  • HY-P1328
    TAT-14
    1 Publications Verification

    		 Keap1-Nrf2 Others
    TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
    TAT-14
  • HY-P1801
    Cys-TAT(47-57)

    Cys-[HIV-TAT (47-57)]

    		 HIV Infection
    Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
    Cys-TAT(47-57)
  • HY-P1801A
    Cys-TAT(47-57) TFA

    Cys-[HIV-TAT (47-57)] TFA

    		 HIV Infection
    Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
    Cys-TAT(47-57) TFA
  • HY-P4114
    TAT-NSF700scr

    		HIV Others
    TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
    TAT-NSF700scr
  • HY-P1328A
    TAT-14 TFA

    		Keap1-Nrf2 Others
    TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
    TAT-14 TFA
  • HY-P4123
    TAT (47-57) GGG-Cys(Npys)

    		HIV Others
    TAT (47-57) GGG-Cys(Npys) is a cell-penetrating peptide (CPP). TAT (47-57) GGG-Cys(Npys) has the potential for intracellular drug delivery research .
    TAT (47-57) GGG-Cys(Npys)
  • HY-P4105
    TAT (47-57), TAMRA-labeled

    		Amino Acid Derivatives Others
    TAT (47-57), TAMRA-labeled is a TAMRA-labeled peptide with cell-penetrating activity.
    TAT (47-57), TAMRA-labeled
  • HY-P1136B
    TAT-Gap19

    		Gap Junction Protein Cardiovascular Disease Inflammation/Immunology
    TAT-Gap19, a Cx mimetic peptide, is a specific connexin43 hemichannel (Cx43 HC) inhibitor. TAT-Gap19 does not inhibits the corresponding Cx43 GJCs. TAT-Gap19 traverses the blood-brain barrier and alleviate liver fibrosis in mice .
    TAT-Gap19
  • HY-P1136C
    TAT-Gap19 TFA

    		Gap Junction Protein Cardiovascular Disease Inflammation/Immunology
    TAT-Gap19 TFA, a Cx mimetic peptide, is a specific connexin43 hemichannel (Cx43 HC) inhibitor. TAT-Gap19 TFA does not inhibits the corresponding Cx43 GJCs. TAT-Gap19 TFA traverses the blood-brain barrier and alleviate liver fibrosis in mice .
    TAT-Gap19 TFA
  • HY-P5277
    TAT-GluN2BCTM

    		DAPK Neurological Disease
    TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .
    TAT-GluN2BCTM
  • HY-P2307A
    Tat-NR2Baa TFA

    		iGluR NO Synthase Neurological Disease
    Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
    Tat-NR2Baa TFA
  • HY-P2307
    Tat-NR2Baa

    		iGluR NO Synthase Neurological Disease
    Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
    Tat-NR2Baa
  • HY-P5754
    TAT-NEP1-40

    		Apoptosis Neurological Disease
    TAT-NEP1-40 is a BBB-penatrable peptide. TAT-NEP1-40 protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
    TAT-NEP1-40
  • HY-P1491
    HIV-1 TAT (48-60)

    		HIV Infection
    HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
    HIV-1 TAT (48-60)
  • HY-P4103
    Cys(Npys)-TAT (47-57), FAM-labeled

    		Amino Acid Derivatives Others
    Cys(Npys)-TAT (47-57), FAM-labeled is a Cys(Npys)-activated cell-penetrating peptide with FAM-labeled .
    Cys(Npys)-TAT (47-57), FAM-labeled
  • HY-P5754A
    TAT-NEP1-40 TFA

    		Apoptosis Neurological Disease
    TAT-NEP1-40 TFA is a BBB-penatrable peptide. TAT-NEP1-40 TFA protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 TFA also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 TFA can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
    TAT-NEP1-40 TFA
  • HY-P2259
    TAT-GluA2 3Y

    		iGluR Neurological Disease
    TAT-GluA2 3Y, an interference peptide, blocks long-term depression (LTD) at glutamatergic synapses by disrupting the endocytosis of AMPAR. TAT-GluA2 3Y can alleviate Pentobarbital-induced spatial memory deficits and synaptic depression .
    TAT-GluA2 3Y
  • HY-P1420
    TAT-cyclo-CLLFVY

    		HIF/HIF Prolyl-Hydroxylase Cancer
    TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
    TAT-cyclo-CLLFVY
  • HY-P3429
    SAMβA

    		PKC Cardiovascular Disease
    SAMβA is conjugated to the cell permeable peptide TAT47-57. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
    SAMβA
  • HY-P10110
    retro-inverso TAT-Beclin 1 (D-amino acid)

    		Autophagy Neurological Disease
    retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
    retro-inverso TAT-Beclin 1 (D-amino acid)
  • HY-P1420A
    TAT-cyclo-CLLFVY TFA

    		HIF/HIF Prolyl-Hydroxylase Cancer
    TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
    TAT-cyclo-CLLFVY TFA
  • HY-P3429A
    SAMβA TFA

    		PKC Cardiovascular Disease
    SAMβA TFA is conjugated to the cell permeable peptide TAT47-57. SAMβA TFA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA TFA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
    SAMβA TFA
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-P3730
    Cdk2/Cyclin Inhibitory Peptide I

    		CDK Cancer
    Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
    Cdk2/Cyclin Inhibitory <em>Peptide</em> I
  • HY-P3731
    Cdk2/Cyclin Inhibitory Peptide II

    		CDK Cancer
    Cdk2/Cyclin Inhibitory Peptide II (Tat-LDL), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
    Cdk2/Cyclin Inhibitory <em>Peptide</em> II
  • HY-P2260
    Tat-beclin 1
    1 Publications Verification

    		 Autophagy HIV Infection
    Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
    Tat-beclin 1
  • HY-P2260A
    Tat-beclin 1 TFA

    		Autophagy HIV Infection
    Tat-beclin 1 TFA, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 TFA decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
    Tat-beclin 1 TFA

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: